Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulinn kappa variable 1D-37 (KVD37)

This Recombinant Human Probable non-functional immunoglobulinn kappa variable 1D-37 (KVD37) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulinn kappa variable 1D-37 IGKV1D-37

UniProt

P0DSN7

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spats2l Mouse Gene Knockout Kit (CRISPR)
KN516570 1 Kit

Spats2l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ramp2 Mouse Gene Knockout Kit (CRISPR)
KN514451 1 Kit

Ramp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calcitonin (CALCA) (NM_001741) Human Over-expression Lysate
LY419771 100 µg

Calcitonin (CALCA) (NM_001741) Human Over-expression Lysate

Sign In for Pricing
View Details
Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), CF®740 Conjugate
#29132 1x 1 mL

Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), CF®740 Conjugate

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF740 conjugate, 0.1mg/mL
BNC742055-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKT1S1 Rabbit Monoclonal Antibody [Clone ID: 23GB640]
TA425133 100 µL

AKT1S1 Rabbit Monoclonal Antibody [Clone ID: 23GB640]

Sign In for Pricing
View Details