Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cAMP-dependent protein kinase inhibitor gamma (IPKG)

This Recombinant Human cAMP-dependent protein kinase inhibitor gamma (IPKG) spans the amino acid sequence from region 1-76. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAMP-dependent protein kinase inhibitor gamma; PKI-gamma; PKIG

UniProt

Q9Y2B9

Expression Region

1-76

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM7 (Proliferation Marker) (MCM7/2756R), CF647 conjugate, 0.1mg/mL
BNC472756-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/2756R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-100 1x 100 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GSK3 beta (GSK3B) pTyr216 Rabbit Polyclonal Antibody
AP02535PU-S 50 µL

GSK3 beta (GSK3B) pTyr216 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Boc-2-Benzyl-4-piperidinone
TRC-B201053-50MG 50 mg

1-Boc-2-Benzyl-4-piperidinone

Sign In for Pricing
View Details
7-Hydroxy-1,3,6-naphthalenetrisulfonic Acid Trisodium Salt
TRC-H950725-25MG 25 mg

7-Hydroxy-1,3,6-naphthalenetrisulfonic Acid Trisodium Salt

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823 + DCS-60.2), CF647 conjugate, 0.1mg/mL
BNC471135-500 1x 500 µL

P21 / WAF1 (CIP1/823 + DCS-60.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details