Fas/CD95, Cynomolgus (HEK293)
Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD) [1][2]. Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases[3][4]. Macaca mulatta Fas receptor contain a death domain (228-312 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Cynomolgus (HEK293) has a full length of 173 amino acids (M1-D173), produced in HEK293 cells with tag free.
Product Specifications
Product Name Alternative
Fas/CD95 Protein, Cynomolgus (HEK293), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fas-cd95-protein-cynomolgus-hek293.html
Purity
95.0
Smiles
QVTDISSKGFELRKIVTTIETQNLEGLHHEGQFCRNPCPPGERKARDCTVNEDEPDCVPCQEGKEYTDKGHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSAVCEHCDPCTKCKHGIIEECTLTSNTKCKEEDSRSD
Molecular Formula
/ (Gene_ID) F6V1W6 (Q26-D173) (Accession)
Molecular Weight
Approximately 19-27 kDa due to the glycosylation.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog