Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 1 (SCGR1)

This Recombinant Human Small cysteine and glycine repeat-containing protein 1 (SCGR1) spans the amino acid sequence from region 1-88. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 1; Keratin-associated protein 28-1; SCYGR1 KRTAP28-1

UniProt

A0A286YEY9

Expression Region

1-88

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGCGGCGGGCGGGCGRCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCSSCGYSCGKGCCQQKCCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAFA4 Human qPCR Primer Pair (NM_182522)
HP233537 200 Reactions

TAFA4 Human qPCR Primer Pair (NM_182522)

Sign In for Pricing
View Details
2,2-Bis(3-Amino-4-hydroxyphenyl(hexafluoropropane))
TRC-B591980-1G 1 g

2,2-Bis(3-Amino-4-hydroxyphenyl(hexafluoropropane))

Sign In for Pricing
View Details
APC Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61249R-BF555-TR 20 µL

APC Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Mouse Kcna10 Pre-designed siRNA Set B
SI107002B 1 Each

Mouse Kcna10 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Reagecon pH 5.00 Buffer Solution at 20°C
10505 500 mL

Reagecon pH 5.00 Buffer Solution at 20°C

Sign In for Pricing
View Details
Hras-1Y i-motif Probe-1
T32104-01 100 mg

Hras-1Y i-motif Probe-1

Sign In for Pricing
View Details