Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin domain-containing protein TINCR (TINCR)

This Recombinant Human Ubiquitin domain-containing protein TINCR (TINCR) spans the amino acid sequence from region 1-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin domain-containing protein TINCR; Placenta-specific protein 2; Terminal differentiation-induced cornification regulator; TINCR LINC00036 NCRNA00036 PLAC2

UniProt

A0A2R8Y7D0

Expression Region

1-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEGLRRGLSRWKRYHIKVHLADEALLLPLTVRPRDTLSDLRAQLVGQGVSSWKRAFYYNARRLDDHQTVRDARLQDGSVLLLVSDPSEAQRLTPAIPALWEAEASRSLESRSSRPAWPTW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCD2 Antibody, Biotin conjugated
CSB-PA846114LD01HU-01 50 µg

SMARCD2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SMARCD2 Antibody, Biotin conjugated
CSB-PA846114LD01HU-02 100 µg

SMARCD2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PPM1D Mouse Monoclonal Antibody [Clone ID: LBI4H3]
AMM20079VCF 100 µg

PPM1D Mouse Monoclonal Antibody [Clone ID: LBI4H3]

Sign In for Pricing
View Details
Human PRAMEF15 qPCR Primer Pair
QH81141S 200 Tests

Human PRAMEF15 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse IFNB1 Protein, Fc Tag
E40MOP1632 20 µg

Mouse IFNB1 Protein, Fc Tag

Sign In for Pricing
View Details
6-Aminobicyclo[3.2.0]heptane-3-carboxylic acid hydrochloride
NKD07028-01 50 mg

6-Aminobicyclo[3.2.0]heptane-3-carboxylic acid hydrochloride

Sign In for Pricing
View Details