Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C)

This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Mouse IgM (mu-chain sp.) -FITC conjugate
40230 0.5 mL

Goat Anti-Mouse IgM (mu-chain sp.) -FITC conjugate

Sign In for Pricing
View Details
PCNA Antibody
orb1260473 100 µL

PCNA Antibody

Sign In for Pricing
View Details
Anti-DSN1 Antibody Picoband® HRP Conjugated
A07949-2-HRP 100 µg/Vial

Anti-DSN1 Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
TAS1R1 Rabbit Polyclonal Antibody (Fluoro550)
orb3099511 100 µg

TAS1R1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Polyclonal Antibody to AMPK Alpha1/AMPK Alpha2 (Phospho-Thr183/Thr172)
35-1173-50 50 μL

Polyclonal Antibody to AMPK Alpha1/AMPK Alpha2 (Phospho-Thr183/Thr172)

Sign In for Pricing
View Details
Als2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4021904 1.0 µg DNA

Als2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details