Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C)

This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal SNF5 Antibody (RM468)
NBP3-18836 100 µL

Rabbit Monoclonal SNF5 Antibody (RM468)

Sign In for Pricing
View Details
AKR1C3-IN-15
T207149-01 10 mg

AKR1C3-IN-15

Sign In for Pricing
View Details
AKR1C3-IN-15
T207149-02 50 mg

AKR1C3-IN-15

Sign In for Pricing
View Details
Anti-Orexin-A Antibody
R-104-100 100 µL

Anti-Orexin-A Antibody

Sign In for Pricing
View Details
Recombinant Mouse FGF-8 Protein
NBP2-35033-500ug 500 µg

Recombinant Mouse FGF-8 Protein

Sign In for Pricing
View Details
Mouse IgA Isotype Control Antibody , APC
E55A08437 50 Tests

Mouse IgA Isotype Control Antibody , APC

Sign In for Pricing
View Details