Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Torsin-1A-interacting protein 2, isoform IFRG15 (IFG15)

This Recombinant Human Torsin-1A-interacting protein 2, isoform IFRG15 (IFG15) spans the amino acid sequence from region 1-131. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Torsin-1A-interacting protein 2, isoform IFRG15; 15 kDa interferon-responsive protein; IFRG15; TOR1AIP2 IFRG15

UniProt

Q9H496

Expression Region

1-131

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKRIHDSRVAGFNPALQLILTRTDKTLNKKLGQNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHPS (NM_001930) Human Recombinant Protein
TP720110M 50 µg

DHPS (NM_001930) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant CD239/BCAM Monoclonal Antibody
AN301706L-01 50 µL

Recombinant CD239/BCAM Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CD239/BCAM Monoclonal Antibody
AN301706L-02 100 µL

Recombinant CD239/BCAM Monoclonal Antibody

Sign In for Pricing
View Details
XPNPEP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B8]
TA503339AM 100 µL

XPNPEP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B8]

Sign In for Pricing
View Details
BMP8B Rabbit Polyclonal Antibody
AP20771PU-N 100 µg

BMP8B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Monkey IgG
AAF-2305-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Monkey IgG

Sign In for Pricing
View Details