Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 3 (SGSN1)

This Recombinant Human Small integral membrane protein 10-like protein 3 (SGSN1) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 3; Salivary gland-specific protein SAGSIN1; SMIM10L3 SAGSIN1

UniProt

A0A0C4DGP1

Expression Region

1-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAALSGLAVRLSRSAAARSYGVFCKGLTRTLLIFFDLAWRLRINFPYLYIVASMMLNVRLQVHIEIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akr7a2 (NM_134407) Rat Untagged Clone
RN200557 10 µg

Akr7a2 (NM_134407) Rat Untagged Clone

Sign In for Pricing
View Details
LIPM, CT (LIPM, LIPL3, Lipase member M, Lipase-like abhydrolase domain-containing protein 3) (APC) discontinued
037820-APC 200 µL

LIPM, CT (LIPM, LIPL3, Lipase member M, Lipase-like abhydrolase domain-containing protein 3) (APC) discontinued

Sign In for Pricing
View Details
Bovine Coagulation Factor V (F5) Antibody Pair Kit (with Standard)
MBS2099289-01 5x 96 Tests

Bovine Coagulation Factor V (F5) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Bovine Coagulation Factor V (F5) Antibody Pair Kit (with Standard)
MBS2099289-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Bovine Coagulation Factor V (F5) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Bovine Coagulation Factor V (F5) Antibody Pair Kit (with Standard)
MBS2099289-03 10x 96 Tests

Bovine Coagulation Factor V (F5) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Bovine Coagulation Factor V (F5) Antibody Pair Kit (with Standard)
MBS2099289-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Bovine Coagulation Factor V (F5) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details