Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54)

This Recombinant Human Testis-expressed protein 54 (TEX54) spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti Human Ig kappa light chain (free and bound), conjugated with TRITC
RAHu/BJK(SD+HD)/TRITC 1 mL

Rabbit anti Human Ig kappa light chain (free and bound), conjugated with TRITC

Sign In for Pricing
View Details
Adeno Associated Virus 4 (AAV4, AAV 4, AAV-4) (MaxLight 650)
MBS6451891-01 0.1 mL

Adeno Associated Virus 4 (AAV4, AAV 4, AAV-4) (MaxLight 650)

Sign In for Pricing
View Details
Adeno Associated Virus 4 (AAV4, AAV 4, AAV-4) (MaxLight 650)
MBS6451891-02 5x 0.1 mL

Adeno Associated Virus 4 (AAV4, AAV 4, AAV-4) (MaxLight 650)

Sign In for Pricing
View Details
MFluor™ Violet 540 Anti-human/monkey CD20 Antibody *2H7*
10202121-AAT 500 Tests

MFluor™ Violet 540 Anti-human/monkey CD20 Antibody *2H7*

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 28B (CCDC28B) ELISA Kit
MBS7208887-01 48 Well

Rabbit Coiled-coil domain-containing protein 28B (CCDC28B) ELISA Kit

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 28B (CCDC28B) ELISA Kit
MBS7208887-02 96 Well

Rabbit Coiled-coil domain-containing protein 28B (CCDC28B) ELISA Kit

Sign In for Pricing
View Details