Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8)

This Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thrombospondin type-1 domain-containing protein 8 THSD8

UniProt

A0A1W2PP97

Expression Region

22-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ALVYQDYQYLGQQGEGDSWEQLRLQHLKEVEDSILGPWGKWRCLCDLGKQERSREVVGTAPGPVFMDPEKLIQLRPCRQRDCPSCKPFDCDWRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EA.hy926 Cell Line, BioGenomicsTM discontinued
550894 1x10e6 cells/vial

EA.hy926 Cell Line, BioGenomicsTM discontinued

Sign In for Pricing
View Details
Rat Monoclonal Serotonin Antibody (YC5/45) [Janelia Fluor 549]
NB100-65037JF549 0.1 mL

Rat Monoclonal Serotonin Antibody (YC5/45) [Janelia Fluor 549]

Sign In for Pricing
View Details
Toxoplasma IgG ELISA Kit
E4673-100 96 Assays

Toxoplasma IgG ELISA Kit

Sign In for Pricing
View Details
SH2B1 (SH2B Adapter Protein 1, Pro-rich, PH and SH2 Domain-containing Signaling Mediator, PSM, SH2 Domain-containing Protein 1B, KIAA1299, SH2B) discontinued
S1013-31D4 100 µg

SH2B1 (SH2B Adapter Protein 1, Pro-rich, PH and SH2 Domain-containing Signaling Mediator, PSM, SH2 Domain-containing Protein 1B, KIAA1299, SH2B) discontinued

Sign In for Pricing
View Details
Savolitinib
BA8873-5.1 1 mL (10 mM in DMSO)

Savolitinib

Sign In for Pricing
View Details
CYP11A1 Rabbit Polyclonal Antibody (APC)
orb2577562 100 µg

CYP11A1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details