Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)

This Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active) spans the amino acid sequence from region 20-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA) ; ACVR2A; ACVR2

UniProt

P27037, A0A7N9IF81

Expression Region

20-135aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human INHBA at 2 μg/mL can bind Human ACVR2A. The EC50 is 74.75-84.73 ng/mL.

Form

Lyophilized powder

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOB1 (POU2AF1) Mouse Monoclonal Antibody [Clone ID: OTI13G1]
CF807999 100 µg

BOB1 (POU2AF1) Mouse Monoclonal Antibody [Clone ID: OTI13G1]

Sign In for Pricing
View Details
CGRP (CALCB) (NM_000728) Human Over-expression Lysate
LY424540 100 µg

CGRP (CALCB) (NM_000728) Human Over-expression Lysate

Sign In for Pricing
View Details
GRK3 Rabbit Polyclonal Antibody
TA384332 100 µL

GRK3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD33 (C33/69), CF594 conjugate, 0.1mg/mL
BNC940069-100 1x 100 µL

CD33 (C33/69), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2-Benzenedicarboxylic Acid 1-(10-Hydroxyundecyl) Ester
TRC-B488585-25MG 25 mg

1,2-Benzenedicarboxylic Acid 1-(10-Hydroxyundecyl) Ester

Sign In for Pricing
View Details
RGL4 Human Gene Knockout Kit (CRISPR)
KN417338 1 Kit

RGL4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details