Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c (CYCS)

This Recombinant Human Cytochrome c (CYCS) spans the amino acid sequence from region 2-105aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P99999

Expression Region

2-105aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Cyclin B2 Antibody
NBP2-98961-100ul 100 µL

Rabbit Polyclonal Cyclin B2 Antibody

Sign In for Pricing
View Details
IRAK1 Blocking Peptide (C-term)
MBS9230219-01 0.5 mg

IRAK1 Blocking Peptide (C-term)

Sign In for Pricing
View Details
IRAK1 Blocking Peptide (C-term)
MBS9230219-02 5x 0.5 mg

IRAK1 Blocking Peptide (C-term)

Sign In for Pricing
View Details
CD65s (CDw65) (MaxLight 405) discontinued
C2405-21D1-ML405 100 µL

CD65s (CDw65) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Ganglioside GD2 (Disialoganglioside GD2)
G2005-02 100 µg

Ganglioside GD2 (Disialoganglioside GD2)

Sign In for Pricing
View Details
4- (Piperidine-4-sulfonyl) -morpholine
OR322811 1 Each

4- (Piperidine-4-sulfonyl) -morpholine

Sign In for Pricing
View Details