Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pentadiplandra brazzeana Defensin-like protein

This Recombinant Pentadiplandra brazzeana Defensin-like protein spans the amino acid sequence from region 1-54aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brazzein

UniProt

P56552

Expression Region

1-54aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Pentadiplandra brazzeana

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGNL1 Knockout MES-OV Polyclonal Cells
ARG6428 1 Million

CGNL1 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
SPEF2-set siRNA/shRNA/RNAi Lentivector (Human)
45269091 4x 500 ng

SPEF2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Lentiviral mouse Polm shRNA (UAS) - Lentiviral mouse Polm shRNA (UAS) (25)
GTR15166313 1 Vial

Lentiviral mouse Polm shRNA (UAS) - Lentiviral mouse Polm shRNA (UAS) (25)

Sign In for Pricing
View Details
Human phosphoglycerate kinase 1, PGK1 ELISA Kit
MBS941880-01 24 Well (LIMIT 1)

Human phosphoglycerate kinase 1, PGK1 ELISA Kit

Sign In for Pricing
View Details
Human phosphoglycerate kinase 1, PGK1 ELISA Kit
MBS941880-02 48 Well

Human phosphoglycerate kinase 1, PGK1 ELISA Kit

Sign In for Pricing
View Details
Human phosphoglycerate kinase 1, PGK1 ELISA Kit
MBS941880-03 96 Well

Human phosphoglycerate kinase 1, PGK1 ELISA Kit

Sign In for Pricing
View Details