Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Remodeling and spacing factor 1 (RSF1), partial

This Recombinant Human Remodeling and spacing factor 1 (RSF1), partial spans the amino acid sequence from region 1343-1441aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBV pX-associated protein 8; Hepatitis B virus X-associated protein; p325 subunit of RSF chromatin-remodeling complex

UniProt

Q96T23

Expression Region

1343-1441aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNJ5 (NM_000890) Human Over-expression Lysate
LY424464 100 µg

KCNJ5 (NM_000890) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Butoxybenzyl Alcohol
TRC-B690995-1G 1 g

4-Butoxybenzyl Alcohol

Sign In for Pricing
View Details
DHFR Antibody
KC-14110-01 50 μL

DHFR Antibody

Sign In for Pricing
View Details
DHFR Antibody
KC-14110-02 100 µL

DHFR Antibody

Sign In for Pricing
View Details
DHFR Antibody
KC-14110-03 1 mL

DHFR Antibody

Sign In for Pricing
View Details
S100A1 Mouse Monoclonal Antibody [Clone ID: OTI2A4]
CF807374 100 µg

S100A1 Mouse Monoclonal Antibody [Clone ID: OTI2A4]

Sign In for Pricing
View Details