Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Simian retrovirus SRV-2 Gag polyprotein (gag), partial

This Recombinant Simian retrovirus SRV-2 Gag polyprotein (gag), partial spans the amino acid sequence from region 2-100aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Core polyprotein

UniProt

P51516

Expression Region

2-100aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Simian retrovirus SRV-2

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQELSQHELYVEQLKKALKTRGVKVKGNDLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKIPVTAFSYWNLIKDLIDKKEADPQVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant LPCAT1 Antibody
RC-6684-01 50 μL

Recombinant LPCAT1 Antibody

Sign In for Pricing
View Details
Recombinant LPCAT1 Antibody
RC-6684-02 100 µL

Recombinant LPCAT1 Antibody

Sign In for Pricing
View Details
Recombinant LPCAT1 Antibody
RC-6684-03 1 mL

Recombinant LPCAT1 Antibody

Sign In for Pricing
View Details
PRRT4 (NM_001114726) Human Over-expression Lysate
LY426504 100 µg

PRRT4 (NM_001114726) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Mouse CTLA-4 (9D9) In Vivo Antibody - Low Endotoxin
ICH1096-25mg 25 mg

Anti-Mouse CTLA-4 (9D9) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR559364 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details