Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Simian retrovirus SRV-2 Gag polyprotein (gag), partial

This Recombinant Simian retrovirus SRV-2 Gag polyprotein (gag), partial spans the amino acid sequence from region 2-100aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Core polyprotein

UniProt

P51516

Expression Region

2-100aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Simian retrovirus SRV-2

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQELSQHELYVEQLKKALKTRGVKVKGNDLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKIPVTAFSYWNLIKDLIDKKEADPQVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant XRCC1 Antibody
RC-5972-01 50 μL

Recombinant XRCC1 Antibody

Sign In for Pricing
View Details
Recombinant XRCC1 Antibody
RC-5972-02 100 µL

Recombinant XRCC1 Antibody

Sign In for Pricing
View Details
Recombinant XRCC1 Antibody
RC-5972-03 1 mL

Recombinant XRCC1 Antibody

Sign In for Pricing
View Details
TRIM45 Human Gene Knockout Kit (CRISPR)
KN415738 1 Kit

TRIM45 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eph receptor B4 (EPHB4) Mouse Monoclonal Antibody [Clone ID: 5B5]
AM06328SU-N 100 µL

Eph receptor B4 (EPHB4) Mouse Monoclonal Antibody [Clone ID: 5B5]

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF568 conjugate, 0.1mg/mL
BNC682561-500 1x 500 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details