Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 11 (Gdf11)

This Recombinant Mouse Growth/differentiation factor 11 (Gdf11) spans the amino acid sequence from region 297-405aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone morphogenetic protein 11

UniProt

Q9Z1W4

Expression Region

297-405aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9130401M01Rik HDR Plasmid (m)
sc-429195-HDR 20 µg

9130401M01Rik HDR Plasmid (m)

Sign In for Pricing
View Details
BFP CRISPR Activation Plasmid (h2)
sc-407408-ACT-2 20 µg

BFP CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
CYP1A1 antibody - middle region (ARP41404_P050)
ARP41404_P050 100 µL

CYP1A1 antibody - middle region (ARP41404_P050)

Sign In for Pricing
View Details
CDC6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0409507 1.0 µg DNA

CDC6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Trim28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4006205 3x 1.0 µg

Trim28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
LOC498685 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV644422 1.0 µg DNA

LOC498685 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details