Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GTPase HRas (HRAS), partial, Biotinylated

This Recombinant Human GTPase HRas (HRAS), partial, Biotinylated spans the amino acid sequence from region 2-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H-Ras-1; Ha-Ras; Transforming protein p21; c-H-ras; p21ras

UniProt

P01112

Expression Region

2-186aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpr1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3654307 1.0 µg DNA

Xpr1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Upk3a-set siRNA/shRNA/RNAi Lentivector (Rat)
49217096 4x 500 ng

Upk3a-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
SAE1 Recombinant Monoclonal Antibody
CSB-RA987582A0HU-01 50 μL

SAE1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
SAE1 Recombinant Monoclonal Antibody
CSB-RA987582A0HU-02 100 µL

SAE1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
IL36G (Interleukin-36 gamma, IL-1-related Protein 2, IL-1RP2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 Family Member 9, IL-1F9, Interleukin-1 Homolog 1, IL-1H1, IL1E, IL1F9, IL1H1, IL1RP2, UNQ2456/PRO5737) (APC)
128431-APC 100 µL

IL36G (Interleukin-36 gamma, IL-1-related Protein 2, IL-1RP2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 Family Member 9, IL-1F9, Interleukin-1 Homolog 1, IL-1H1, IL1E, IL1F9, IL1H1, IL1RP2, UNQ2456/PRO5737) (APC)

Sign In for Pricing
View Details
2-Butylfuran
sc-265506A 50 g

2-Butylfuran

Sign In for Pricing
View Details