Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Notechis scutatus scutatus Basic phospholipase A2 notechis II-5

This Recombinant Notechis scutatus scutatus Basic phospholipase A2 notechis II-5 spans the amino acid sequence from region 1-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

UniProt

P00609

Expression Region

1-119aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Notechis scutatus scutatus (Mainland tiger snake)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLVQFSYLIQCANHGRRPTRHYMDYGCYCGWGGSGTPVDELDRCCKIHDDCYSDAEKKGCSPKMSAYDYYCGENGPYCRNIKKKCLRFVCDCDVEAAFCFAKAPYNNANWNIDTKKRCQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEK Polyclonal Antibody
MBS9133381-01 0.02 mL

PLEK Polyclonal Antibody

Sign In for Pricing
View Details
PLEK Polyclonal Antibody
MBS9133381-02 0.1 mL

PLEK Polyclonal Antibody

Sign In for Pricing
View Details
PLEK Polyclonal Antibody
MBS9133381-03 5x 0.1 mL

PLEK Polyclonal Antibody

Sign In for Pricing
View Details
PRDM3 Polyclonal Antibody
JOT-AP07389-01 50ul

PRDM3 Polyclonal Antibody

Sign In for Pricing
View Details
PRDM3 Polyclonal Antibody
JOT-AP07389-02 100ul

PRDM3 Polyclonal Antibody

Sign In for Pricing
View Details
CSNK1D sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0517306 1.0 µg DNA

CSNK1D sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details