Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Usherin (USH2A), partial

This Recombinant Macaca fascicularis Usherin (USH2A), partial spans the amino acid sequence from region 5130-5268aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

USH2A

UniProt

A0A2K5VJI1

Expression Region

5130-5268aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QRKILKEPYIRERPPLVPLQKRMSPLNVYPPGENHMGLADTKIPRSGTPVSIRSNRSACVLRIPSQSQTGLTYSQGSLHRSVSQLMDVQDKKVLMDDSLWEAIMGHKSGLYVDEEDLMNAIKGFSSVTKEHTTFTDTHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glass-Coated Multi-Well Plates
DP36VR-9-GC10 10 Plates/Pack

Glass-Coated Multi-Well Plates

Sign In for Pricing
View Details
Recombinant Porcine GFAP protein (His tag)
PDEP100010-01 20 µg

Recombinant Porcine GFAP protein (His tag)

Sign In for Pricing
View Details
Recombinant Porcine GFAP protein (His tag)
PDEP100010-02 100 µg

Recombinant Porcine GFAP protein (His tag)

Sign In for Pricing
View Details
Recombinant Porcine GFAP protein (His tag)
PDEP100010-03 500 µg

Recombinant Porcine GFAP protein (His tag)

Sign In for Pricing
View Details
Recombinant Porcine GFAP protein (His tag)
PDEP100010-04 1 mg

Recombinant Porcine GFAP protein (His tag)

Sign In for Pricing
View Details
MLC1SA (MYL6B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F10]
TA811146AM 100 µL

MLC1SA (MYL6B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F10]

Sign In for Pricing
View Details