Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prohibitin-2 (PHB2)

This Recombinant Human Prohibitin-2 (PHB2) spans the amino acid sequence from region 1-299aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein BAP37; D-prohibitin; Repressor of estrogen receptor activity

UniProt

Q99623

Expression Region

1-299aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLKL (Ser345) Recombinant Rabbit mAb, Cy3 conjugated
orb2349666 100 µL

MLKL (Ser345) Recombinant Rabbit mAb, Cy3 conjugated

Sign In for Pricing
View Details
NFKBIZ Peptide
DF12429-BP 1 mg

NFKBIZ Peptide

Sign In for Pricing
View Details
8- Bromoadenine (8-Br-Ade)
B 052-50 5x 10 µmol

8- Bromoadenine (8-Br-Ade)

Sign In for Pricing
View Details
Pgk2 sgRNA CRISPR Lentivector set (Mouse)
K3822201 3x 1.0 µg

Pgk2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Solifenacin hydrochloride
E6073-1g 1 g

Solifenacin hydrochloride

Sign In for Pricing
View Details
Calpain 5 (CAPN5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D2]
TA804810AM 100 µL

Calpain 5 (CAPN5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D2]

Sign In for Pricing
View Details