Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast growth factor 21 (Fgf21)

This Recombinant Mouse Fibroblast growth factor 21 (Fgf21) spans the amino acid sequence from region 29-210aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-21

UniProt

Q9JJN1

Expression Region

29-210aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGPAT3 (NM_001037553) Human Over-expression Lysate
LC421923 20 µg

AGPAT3 (NM_001037553) Human Over-expression Lysate

Sign In for Pricing
View Details
Bendiocarb
TRC-B119900-500MG 500 mg

Bendiocarb

Sign In for Pricing
View Details
SIAT4A (ST3GAL1) Rabbit Polyclonal Antibody
TA382058 100 µL

SIAT4A (ST3GAL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SmartSeal™ Semi-Automated Microplate Sealer, 230V
MS1000-E 1 Each

SmartSeal™ Semi-Automated Microplate Sealer, 230V

Sign In for Pricing
View Details
Dechlorane A
TRC-D226215-25MG 25 mg

Dechlorane A

Sign In for Pricing
View Details
Recombinant Human IL17RA Protein (Fc Tag)
PKSH033395-01 10 µg

Recombinant Human IL17RA Protein (Fc Tag)

Sign In for Pricing
View Details