Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interferon gamma (IFNG)

This Recombinant Macaca mulatta Interferon gamma (IFNG) spans the amino acid sequence from region 24-165aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-gamma; IFNG

UniProt

P63310

Expression Region

24-165aa

Tag

C-terminal mTagBFP2-G4S-10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAMP4 Protein Vector (Mouse) (pPM-C-HA)
PV226840 500 ng

SCAMP4 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Pulmonary surfactant-associated protein B
MBS2889312 Inquire

Pulmonary surfactant-associated protein B

Sign In for Pricing
View Details
TNNI2 Rabbit Monoclonal Antibody
orb2988794-01 30 µL

TNNI2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TNNI2 Rabbit Monoclonal Antibody
orb2988794-02 50 µL

TNNI2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TNNI2 Rabbit Monoclonal Antibody
orb2988794-03 100 µL

TNNI2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TNNI2 Rabbit Monoclonal Antibody
orb2988794-04 200 µL

TNNI2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details