Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sorcin (Sri)

This Recombinant Mouse Sorcin (Sri) spans the amino acid sequence from region 1-198aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sri

UniProt

Q6P069

Expression Region

1-198aa

Tag

N-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLSPQTVNSVAKRYSTSGKITFDDYIACCVKLRALTDSFRRRDSGQQGVVNFSYDDFIQCVMTV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Gp2 ELISA Kit
ELI-39025r 96 Tests

Rat Gp2 ELISA Kit

Sign In for Pricing
View Details
Anti-M Cadherin/CDH15 Antibody Picoband® (Dylight488 Conjugate)
A10888-1-Dylight488 100 µg

Anti-M Cadherin/CDH15 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Recombinant Human Nectin-2 (C-mIgG2a Fc)
32-11191-10 10 µg

Recombinant Human Nectin-2 (C-mIgG2a Fc)

Sign In for Pricing
View Details
ZCCHC7 3'UTR Luciferase Stable Cell Line
TU028774 1.0 mL

ZCCHC7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Phloroglucinol 99.3% Anhydrous
GPC2233-X 100 g

Phloroglucinol 99.3% Anhydrous

Sign In for Pricing
View Details
Hamster TBC1 Domain Family Member 12 (TBC1D12) ELISA Kit
MBS9353172-01 48 Well

Hamster TBC1 Domain Family Member 12 (TBC1D12) ELISA Kit

Sign In for Pricing
View Details