Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD276 antigen (CD276) -VLPs

This Recombinant Human CD276 antigen (CD276) -VLPs spans the amino acid sequence from region 29-534aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

Product Name Alternative

4Ig-B7-H3; B7 homolog 3 (B7-H3) ; Costimulatory molecule

UniProt

Q5ZPR3

Expression Region

29-534aa

Tag

C-terminal EGFP-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

81.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ectonucleotide Pyrophosphatase/Phosphodiesterase 4 (ENPP4) ELISA Kit
201-12-3682 96 Tests

Human Ectonucleotide Pyrophosphatase/Phosphodiesterase 4 (ENPP4) ELISA Kit

Sign In for Pricing
View Details
CD19 Recombinant Protein (Mouse)
RP122384 100 µg

CD19 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Mtch1-set siRNA/shRNA/RNAi Lentivector (Mouse)
30855094 4x 500 ng

Mtch1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
GM130 Polyclonal Antibody, Cy5 Conjugated
bs-24915R-Cy5 100 µL

GM130 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
RB-PEG-OH (MW 5000)
T211692-01 10 mg

RB-PEG-OH (MW 5000)

Sign In for Pricing
View Details
RB-PEG-OH (MW 5000)
T211692-02 50 mg

RB-PEG-OH (MW 5000)

Sign In for Pricing
View Details