Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Interleukin-2 receptor subunit alpha (IL2RA), partial

This Recombinant Pig Interleukin-2 receptor subunit alpha (IL2RA), partial spans the amino acid sequence from region 22-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA; CD antigen CD25

UniProt

O02733

Expression Region

22-245aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GACVQQPPSLRNATFKILGYKVGTTLNCDCQRGFRRDPSSGPYMICRGNSSHSFWENKCQCMPTSSPRIPVKQVTPRPEEQKERKTTETQGQMQPPNQANLPGHCKEPPPWEHESLKRVYHFMEGQTVRYQCLPGFRDGSAQNNSAQSVCKKQEDQEVMRWTQPKLKCKSEKENGSFPEPQMSTAAPPTTKTSLPTRTKGTTDSQNLTEVPATMQPIIFTTQYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit
MBS453112-01 48 Tests

Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit
MBS453112-02 96 Tests

Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit
MBS453112-03 5x 96 Tests

Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit
MBS453112-04 10x 96 Tests

Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit

Sign In for Pricing
View Details
pOTB7-SH3BP1 Plasmid
PVT30284 2 µg

pOTB7-SH3BP1 Plasmid

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) YIEH Polyclonal Antibody
MBS7156246 Inquire

Rabbit anti-Escherichia coli (strain K12) YIEH Polyclonal Antibody

Sign In for Pricing
View Details