Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MAP kinase-activating death domain protein (MADD), partial

This Recombinant Human MAP kinase-activating death domain protein (MADD), partial spans the amino acid sequence from region 1409-1506aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Differentially expressed in normal and neoplastic cells; Insulinoma glucagonoma clone 20; Rab3 GDP/GTP exchange factor; RabGEF; Rab3 GDP/GTP exchange protein; Rab3GEP

UniProt

Q8WXG6

Expression Region

1409-1506aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEX4 Rabbit Polyclonal Antibody
orb586587 100 µL

BEX4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCP2 AAV Vector (Mouse) (CMV)
36228105 1 µg

PCP2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Goat anti Human Factor XII
GAHu/FXII 1 mL

Goat anti Human Factor XII

Sign In for Pricing
View Details
Groenlandicine 1mg
A22176-1 1 mg

Groenlandicine 1mg

Sign In for Pricing
View Details
Rat NOS1 (Nitric Oxide Synthase 1, Neuronal) ELISA Kit
MBS8800621-01 48 Well

Rat NOS1 (Nitric Oxide Synthase 1, Neuronal) ELISA Kit

Sign In for Pricing
View Details
Rat NOS1 (Nitric Oxide Synthase 1, Neuronal) ELISA Kit
MBS8800621-02 96 Well

Rat NOS1 (Nitric Oxide Synthase 1, Neuronal) ELISA Kit

Sign In for Pricing
View Details