Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial

This Recombinant Bordetella pertussis Pertactin autotransporter (prn), partial spans the amino acid sequence from region 41-142aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P.93

UniProt

P14283

Expression Region

41-142aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVKTGERQHGIHIQGSDPGGVRTASGTTIKVSGRQAQGILLENPAAELQFRNGSVTSSGQLSDDGIRRFLGTVTVKAGKLVADHATLANVGDTWDDDGIALY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat ANXA2 Protein, His (Fc)-Avi-tagged
ANXA2-345R 50 µg

Recombinant Rat ANXA2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
TMEM177 Antibody, FITC conjugated
A36836-100UG 100 µg

TMEM177 Antibody, FITC conjugated

Sign In for Pricing
View Details
Triethylhexylammonium Bromide
OR1015329-01 1 g

Triethylhexylammonium Bromide

Sign In for Pricing
View Details
Triethylhexylammonium Bromide
OR1015329-02 5 g

Triethylhexylammonium Bromide

Sign In for Pricing
View Details
Triethylhexylammonium Bromide
OR1015329-03 25 g

Triethylhexylammonium Bromide

Sign In for Pricing
View Details
Triethylhexylammonium Bromide
OR1015329-04 100 g

Triethylhexylammonium Bromide

Sign In for Pricing
View Details