Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Large ribosomal subunit protein bL12 (rplL)

This Recombinant Pseudomonas aeruginosa Large ribosomal subunit protein bL12 (rplL) spans the amino acid sequence from region 1-122aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9HWC8

Expression Region

1-122aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PR

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALTNEDIINAVSEMSVMQVVELIKAMEEKFGVTAAAATVAAAGPAAAAAEEQTEFTIVLAEAGDKKVNVIKVVRELTGLGLKEAKAVVDGAPGVVKEGASKEEAEAAKKALEEAGAKVELK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MEKK2 (MAP3K2) activation kit by CRISPRa
GA107364 1 Kit

Human MEKK2 (MAP3K2) activation kit by CRISPRa

Sign In for Pricing
View Details
Human Eye Ball
4072250/A 1 Each

Human Eye Ball

Sign In for Pricing
View Details
Influenza A Matched Antibody Pair Set [Z01LS-0722-LS497]
Z01LS-0722-LS497 5 Plates

Influenza A Matched Antibody Pair Set [Z01LS-0722-LS497]

Sign In for Pricing
View Details
Alr2 Antibody
orb853399 2 mg

Alr2 Antibody

Sign In for Pricing
View Details
4-Chloroloratadine
T20815-01 1 mg

4-Chloroloratadine

Sign In for Pricing
View Details
4-Chloroloratadine
T20815-02 100 mg

4-Chloroloratadine

Sign In for Pricing
View Details