Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-1B (ACVR1B), partial

This Recombinant Human Activin receptor type-1B (ACVR1B), partial spans the amino acid sequence from region 24-126aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type IB; ACTR-IB; Activin receptor-like kinase 4; ALK-4; Serine/threonine-protein kinase receptor R2; SKR2

UniProt

P36896

Expression Region

24-126aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARD3 Antibody, HRP conjugated
A61597-50UG 50 µg

PARD3 Antibody, HRP conjugated

Sign In for Pricing
View Details
NFkB p65 antibody (Thr505)
70R-37243 0.1 mg

NFkB p65 antibody (Thr505)

Sign In for Pricing
View Details
Recombinant Human CISD3 Protein
E30P64180A 50 µg

Recombinant Human CISD3 Protein

Sign In for Pricing
View Details
Zp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6984705 3x 1.0 µg

Zp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Human STMN1 Protein, N-His
orb2969064-01 50 µg

Recombinant Human STMN1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human STMN1 Protein, N-His
orb2969064-02 100 µg

Recombinant Human STMN1 Protein, N-His

Sign In for Pricing
View Details