Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 alpha (IL1A)

This Recombinant Human Interleukin-1 alpha (IL1A) spans the amino acid sequence from region 113-271aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-1 alpha; Hematopoietin-1

UniProt

P01583

Expression Region

113-271aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TRF-2 Antibody
NB110-57130 0.1 mL

Rabbit Polyclonal TRF-2 Antibody

Sign In for Pricing
View Details
Cavy Zinc Finger ZZ-Type and EF-Hand Domain-Containing Protein 1 (ZZEF1) ELISA Kit
MBS9913378 Inquire

Cavy Zinc Finger ZZ-Type and EF-Hand Domain-Containing Protein 1 (ZZEF1) ELISA Kit

Sign In for Pricing
View Details
GPD2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
22460064 1.0 µg DNA

GPD2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DNAJC17 (NM_018163) Human Over-expression Lysate
LC413260 20 µg

DNAJC17 (NM_018163) Human Over-expression Lysate

Sign In for Pricing
View Details
TP63 Detection Antibody
OAOA22221-50UG 50 µg

TP63 Detection Antibody

Sign In for Pricing
View Details
53BP1 (TP53BP1) (NM_005657) Human Tagged ORF Clone Lentiviral Particle
RC218016L1V 200 µL

53BP1 (TP53BP1) (NM_005657) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details