Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial

This Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial spans the amino acid sequence from region 204-297aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O16470

Expression Region

204-297aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARPP21 siRNA (Human)
MBS8222185-01 15 nmol

ARPP21 siRNA (Human)

Sign In for Pricing
View Details
ARPP21 siRNA (Human)
MBS8222185-02 30 nmol

ARPP21 siRNA (Human)

Sign In for Pricing
View Details
ARPP21 siRNA (Human)
MBS8222185-03 5x 30 nmol

ARPP21 siRNA (Human)

Sign In for Pricing
View Details
Rabbit anti-14-3-3 Sigma Antibody, Affinity Purified
A301-648A 100 µg

Rabbit anti-14-3-3 Sigma Antibody, Affinity Purified

Sign In for Pricing
View Details
ELISA Kit FOR C-terminal-binding protein 1
E16380r 96 Tests

ELISA Kit FOR C-terminal-binding protein 1

Sign In for Pricing
View Details
TCTE1 Polyclonal Conjugated Antibody
C28875 100 µL

TCTE1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details