Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuronal acetylcholine receptor subunit alpha-7 (Chrna7), partial

This Recombinant Mouse Neuronal acetylcholine receptor subunit alpha-7 (Chrna7), partial spans the amino acid sequence from region 23-230aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NAChR7; Nicotinic acetylcholine receptor subunit alpha-7

UniProt

P49582

Expression Region

23-230aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GEFQRRLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM81A activation kit by CRISPRa
GA115532 1 Kit

Human FAM81A activation kit by CRISPRa

Sign In for Pricing
View Details
Arylex
TRC-A794890-2.5MG 2.5 mg

Arylex

Sign In for Pricing
View Details
Human ZNF697 activation kit by CRISPRa
GA114071 1 Kit

Human ZNF697 activation kit by CRISPRa

Sign In for Pricing
View Details
1-Ethyl-5-fluoroindoline-2,3-dione
TRC-E940235-500MG 500 mg

1-Ethyl-5-fluoroindoline-2,3-dione

Sign In for Pricing
View Details
Ccn5 Mouse Gene Knockout Kit (CRISPR)
KN519438 1 Kit

Ccn5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myristoyl-L-carnitine-d3 Hydrochloride
TRC-M884747-25MG 25 mg

Myristoyl-L-carnitine-d3 Hydrochloride

Sign In for Pricing
View Details