Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuronal acetylcholine receptor subunit alpha-7 (Chrna7), partial

This Recombinant Mouse Neuronal acetylcholine receptor subunit alpha-7 (Chrna7), partial spans the amino acid sequence from region 23-230aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NAChR7; Nicotinic acetylcholine receptor subunit alpha-7

UniProt

P49582

Expression Region

23-230aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GEFQRRLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF594 conjugate, 0.1mg/mL
BNC940940-500 1x 500 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ketohexokinase Recombinant Rabbit Monoclonal Antibody [PSH03-18]
HA721949 100 µL

ketohexokinase Recombinant Rabbit Monoclonal Antibody [PSH03-18]

Sign In for Pricing
View Details
Tissue Total RNA, Cervix
CR561343 5 µg

Tissue Total RNA, Cervix

Sign In for Pricing
View Details
OR56A3 Antibody
8G868-AAT 50 µg

OR56A3 Antibody

Sign In for Pricing
View Details
Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3731), CF647 conjugate, 0.1mg/mL
BNC473731-100 1x 100 µL

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3731), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZBTB3 (NM_024784) Human Over-expression Lysate
LC403029 20 µg

ZBTB3 (NM_024784) Human Over-expression Lysate

Sign In for Pricing
View Details