Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ragulator complex protein LAMTOR3 (LAMTOR3)

This Recombinant Human Ragulator complex protein LAMTOR3 (LAMTOR3) spans the amino acid sequence from region 1-124aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3; MEK-binding partner 1; Mp1; Mitogen-activated protein kinase kinase 1-interacting protein 1; Mitogen-activated protein kinase scaffold protein 1

UniProt

Q9UHA4

Expression Region

1-124aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (ABHD5)
CSB-EP819884HU-01 20 µg

Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (ABHD5)

Sign In for Pricing
View Details
Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (ABHD5)
CSB-EP819884HU-02 100 µg

Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (ABHD5)

Sign In for Pricing
View Details
Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (ABHD5)
CSB-EP819884HU-03 1 mg

Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (ABHD5)

Sign In for Pricing
View Details
SIAHBP1 (Siah-binding Protein 1, PUF60, Poly-U Binding Splicing Factor 60kD, FIR, VRJS, RoBPI) (FITC)
MBS6449355-01 0.1 mL

SIAHBP1 (Siah-binding Protein 1, PUF60, Poly-U Binding Splicing Factor 60kD, FIR, VRJS, RoBPI) (FITC)

Sign In for Pricing
View Details
SIAHBP1 (Siah-binding Protein 1, PUF60, Poly-U Binding Splicing Factor 60kD, FIR, VRJS, RoBPI) (FITC)
MBS6449355-02 5x 0.1 mL

SIAHBP1 (Siah-binding Protein 1, PUF60, Poly-U Binding Splicing Factor 60kD, FIR, VRJS, RoBPI) (FITC)

Sign In for Pricing
View Details
HSA (Human Serum Albumin, Human Albumin) (MaxLight 405)
MBS6263573-01 0.1 mL

HSA (Human Serum Albumin, Human Albumin) (MaxLight 405)

Sign In for Pricing
View Details