Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC Class I chain-related protein (MICA), partial

This Recombinant Human MHC Class I chain-related protein (MICA), partial spans the amino acid sequence from region 24-309aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC Class I chain-related protein; MHC class I polypeptide-related sequence A; MICA

UniProt

J9TPG6

Expression Region

24-309aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCU Recombinant Rabbit monoclonal Antibody
HA751487 100 µL

MCU Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
1,2,4-Triazole-3-carboxylic Acid
TRC-T767395-1G 1 g

1,2,4-Triazole-3-carboxylic Acid

Sign In for Pricing
View Details
TRIM54 Antibody
KC-14759-01 50 μL

TRIM54 Antibody

Sign In for Pricing
View Details
TRIM54 Antibody
KC-14759-02 100 µL

TRIM54 Antibody

Sign In for Pricing
View Details
TRIM54 Antibody
KC-14759-03 1 mL

TRIM54 Antibody

Sign In for Pricing
View Details
TGF beta 1 Recombinant Rabbit monoclonal Antibody
HA723727B 100 µL

TGF beta 1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details