Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC Class I chain-related protein (MICA), partial

This Recombinant Human MHC Class I chain-related protein (MICA), partial spans the amino acid sequence from region 24-309aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC Class I chain-related protein; MHC class I polypeptide-related sequence A; MICA

UniProt

J9TPG6

Expression Region

24-309aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 Rabbit Polyclonal Antibody
orb334580 100 µg

CD14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CTLA4 Antibody -iFluor647 Conjugate
A00020-2-iFluor647 100 µg

Anti-CTLA4 Antibody -iFluor647 Conjugate

Sign In for Pricing
View Details
Cryptochrome 1 Rabbit Polyclonal Antibody (PE-Cy7)
orb870947 100 µL

Cryptochrome 1 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
PMS2 Polyclonal Antibody
MBS2519379-01 0.02 mL

PMS2 Polyclonal Antibody

Sign In for Pricing
View Details
PMS2 Polyclonal Antibody
MBS2519379-02 0.06 mL

PMS2 Polyclonal Antibody

Sign In for Pricing
View Details
PMS2 Polyclonal Antibody
MBS2519379-03 0.12 mL

PMS2 Polyclonal Antibody

Sign In for Pricing
View Details