Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flock house virus Protein B2 (B2), Biotinylated

This Recombinant Flock house virus Protein B2 (B2), Biotinylated spans the amino acid sequence from region 1-106aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B2

UniProt

P68831

Expression Region

1-106aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Flock house virus (FHV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEGKAPEEAKPTLEERLRKLELSHSLPTTGSDPPPAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BstDSI, 500U
RE1214 500 U

BstDSI, 500U

Sign In for Pricing
View Details
Recombinant Human CD8A
P1640-01 50 µg

Recombinant Human CD8A

Sign In for Pricing
View Details
Recombinant Human CD8A
P1640-02 200 µg

Recombinant Human CD8A

Sign In for Pricing
View Details
Recombinant Human CD8A
P1640-03 1 mg

Recombinant Human CD8A

Sign In for Pricing
View Details
Dennd2d sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6433708 1.0 µg DNA

Dennd2d sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
HDAC6 cDNA Clone
MBS1277435-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

HDAC6 cDNA Clone

Sign In for Pricing
View Details