Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL23A&IL12B Heterodimer Protein (Active)

This Recombinant Human Interleukin-23 alpha&Interleukin-12 beta Heterodimer Protein (IL23A&IL12B) spans the amino acid sequence from region 20-189aa&23-328aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9NPF7, P29460

Expression Region

20-189aa (IL23A) & 23-328aa (IL12B)

Tag

N-terminal 10xHis-tagged & C-terminal Twin-Strep-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Human IL23A&IL12B at 2 μg/mL can bind Anti-IL23A&IL12B recombinant antibody. The EC50 is 0.7293-0.8610 ng/mL. 2IL23A&IL12B Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Human IL23A&IL12B with an affinity constant of 0.158 nM as detected by MetaSPR Assay.

Form

Lyophilized powder

Molecular Weight

22.3 kDa & 37.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-2-Aminobutyric-3,3-d2 Acid
TRC-A602941-10MG 10 mg

L-2-Aminobutyric-3,3-d2 Acid

Sign In for Pricing
View Details
Premazepam
TRC-P712650-25MG 25 mg

Premazepam

Sign In for Pricing
View Details
TentaGel® S NPC
S30050.25G 25 g

TentaGel® S NPC

Sign In for Pricing
View Details
L-Lactic Acid (LA) Colorimetric Assay Kit
E-BC-K044-M-01 48 T (32 samples)

L-Lactic Acid (LA) Colorimetric Assay Kit

Sign In for Pricing
View Details
L-Lactic Acid (LA) Colorimetric Assay Kit
E-BC-K044-M-02 96 T (80 samples)

L-Lactic Acid (LA) Colorimetric Assay Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS620016 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details