Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sendai virus Fusion glycoprotein F0 (F), partial

This Recombinant Sendai virus Fusion glycoprotein F0 (F), partial spans the amino acid sequence from region 26-116aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein F; F

UniProt

P04855

Expression Region

26-116aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Sendai virus (strain Z) (SeV) (Sendai virus (strain HVJ) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QIPRDRLSNIGVIVDEGKSLKIAGSHESRYIVLSLVPGVDFENGCGTAQVIQYKSLLNRLLIPLRDALDLQEALITVTNDTTQNAGAPQSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDH11 Antibody
C47240-01 50 µL

ZDH11 Antibody

Sign In for Pricing
View Details
ZDH11 Antibody
C47240-02 100 µL

ZDH11 Antibody

Sign In for Pricing
View Details
Spink14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7587006 1.0 µg DNA

Spink14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rat Anti-Ryanodine Receptor 1 antibody (RYR1-Ab) ELISA kit
GTR10388734 96 Well

Rat Anti-Ryanodine Receptor 1 antibody (RYR1-Ab) ELISA kit

Sign In for Pricing
View Details
EVR3 siRNA Oligos set (Human)
19549171 3x 5 nmol

EVR3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Escherichia coli Transposase insE for insertion sequence IS3B (insE2)
MBS1001268-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Transposase insE for insertion sequence IS3B (insE2)

Sign In for Pricing
View Details