Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Protein Rv1269c

This Recombinant Mycobacterium tuberculosis Protein Rv1269c spans the amino acid sequence from region 36-124aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P9WM45

Expression Region

36-124aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADVYGAIAYSGNGSWGRSWDYPTRAAAEATAVKSCGYSDCKVLTSFTACGAVAANDRAYQGGVGPTLAAAMKDALTKLGGGYIDTWACN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad9 (RAD9A) pSer272 Rabbit Polyclonal Antibody
AP12684PU-N 400 µL

Rad9 (RAD9A) pSer272 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNAP25 (193-206) Goat Polyclonal Antibody
AP08782PU-N 50 µg

SNAP25 (193-206) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR562641 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
SPATA7 (C-term) Rabbit Polyclonal Antibody
AP54003PU-N 400 µL

SPATA7 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-(4-Chlorophenyl)-1-phenylethanol
TRC-C380475-250MG 250 mg

1-(4-Chlorophenyl)-1-phenylethanol

Sign In for Pricing
View Details
Sodium Periodate
TRC-S665000-10G 10 g

Sodium Periodate

Sign In for Pricing
View Details