Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Protein Rv1269c

This Recombinant Mycobacterium tuberculosis Protein Rv1269c spans the amino acid sequence from region 36-124aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P9WM45

Expression Region

36-124aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADVYGAIAYSGNGSWGRSWDYPTRAAAEATAVKSCGYSDCKVLTSFTACGAVAANDRAYQGGVGPTLAAAMKDALTKLGGGYIDTWACN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (K8.8), 0.2mg/mL
BNUB0689-100 1x 100 µL

Cytokeratin 8 (K8.8), 0.2mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF488A conjugate, 0.1mg/mL
BNC883803-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ebastine-d5
TRC-E320002-1MG 1 mg

Ebastine-d5

Sign In for Pricing
View Details
Histone H4 (Ab-8) Antibody
8D0032-AAT 50 µg

Histone H4 (Ab-8) Antibody

Sign In for Pricing
View Details
CASK (NM_003688) Human Over-expression Lysate
LC401218 20 µg

CASK (NM_003688) Human Over-expression Lysate

Sign In for Pricing
View Details
PI 3 Kinase p55 gamma (PIK3R3) Rabbit Polyclonal Antibody
TA379940 100 µL

PI 3 Kinase p55 gamma (PIK3R3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details