Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 receptor antagonist protein (IL1RN)

This Recombinant Human Interleukin-1 receptor antagonist protein (IL1RN) spans the amino acid sequence from region 26-177aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ICIL-1RA; IL1 inhibitor

UniProt

P18510

Expression Region

26-177aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pappalysin 2 (PAPPA2) Polyclonal Antibody
CAU23307-01 100 µL

Pappalysin 2 (PAPPA2) Polyclonal Antibody

Sign In for Pricing
View Details
Pappalysin 2 (PAPPA2) Polyclonal Antibody
CAU23307-02 200 µL

Pappalysin 2 (PAPPA2) Polyclonal Antibody

Sign In for Pricing
View Details
Pappalysin 2 (PAPPA2) Polyclonal Antibody
CAU23307-03 1 mL

Pappalysin 2 (PAPPA2) Polyclonal Antibody

Sign In for Pricing
View Details
Lanthanum boride
sc-250229 5 g

Lanthanum boride

Sign In for Pricing
View Details
Brn-2 (A-11) X
sc-398966 X 200 µg - 0.1 mL

Brn-2 (A-11) X

Sign In for Pricing
View Details
Klf2 ORF Vector (Rat) (pORF)
ORF069089 1.0 µg DNA

Klf2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details