Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-6 (CLDN6), partial-VLPs

This Recombinant Human Claudin-6 (CLDN6), partial-VLPs spans the sequence from region 29-102aa.

Product Specifications

Product Name Alternative

Skullin

UniProt

P56747

Expression Region

29-102aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

65.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR561027 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Noradrenalone Hydrochloride
TRC-N661035-500MG 500 mg

Noradrenalone Hydrochloride

Sign In for Pricing
View Details
(+)-Catechin-d4
TRC-C217501-5MG 5 mg

(+)-Catechin-d4

Sign In for Pricing
View Details
OR9G9 Human Gene Knockout Kit (CRISPR)
KN420784 1 Kit

OR9G9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (C-term) Goat Polyclonal Antibody
AP08504PU-N 50 µg

Parathyroid Hormone (PTH) (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Arhgap19 Mouse Gene Knockout Kit (CRISPR)
KN501493 1 Kit

Arhgap19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details