Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active)

This Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial spans the amino acid sequence from region 25-231aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokine receptor-like factor 2; Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor (TSLP receptor) ; CRLF2; CRL2, ILXR, TSLPR

UniProt

Q9HC73

Expression Region

25-231aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human TSLP at 2 μg/mL can bind Human CRLF2 protein. The EC50 is 41.01-45.10 ng/mL.

Form

Lyophilized powder

Molecular Weight

52.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGG Protein Vector (Mouse) (pPM-C-His)
PV179417 500 ng

FGG Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Cuedc1 (NM_198013) Mouse Tagged ORF Clone Lentiviral Particle
MR206064L4V 200 µL

Cuedc1 (NM_198013) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NUCB2 Rabbit pAb
E45R19268N 50 ul

NUCB2 Rabbit pAb

Sign In for Pricing
View Details
APC/Cyanine7 anti-mouse CD4
GT00126 25 µg

APC/Cyanine7 anti-mouse CD4

Sign In for Pricing
View Details
Granulocyte (FITC)
MBS6122264-01 0.1 mL

Granulocyte (FITC)

Sign In for Pricing
View Details
Granulocyte (FITC)
MBS6122264-02 5x 0.1 mL

Granulocyte (FITC)

Sign In for Pricing
View Details