Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active)
This Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial spans the amino acid sequence from region 25-231aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cytokine receptor-like factor 2; Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor (TSLP receptor) ; CRLF2; CRL2, ILXR, TSLPR
UniProt
Q9HC73
Expression Region
25-231aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology; Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.
Bioactivity
Measured by its binding ability in a functional ELISA.Immobilized Human TSLP at 2 μg/mL can bind Human CRLF2 protein. The EC50 is 41.01-45.10 ng/mL.
Form
Lyophilized powder
Molecular Weight
52.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E45H51181I2-20-ug 20 ug
ACE2 Protein, Human, Recombinant (His Tag), HPLC-verified
Sign In for Pricing
View Details 
