Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor IX (F9), partial

This Recombinant Human Coagulation factor IX (F9), partial spans the amino acid sequence from region 93-171aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Christmas factor; Plasma thromboplastin component

UniProt

P00740

Expression Region

93-171aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP250 Antibody
CSB-PA871581LA01HU-01 50 µg

CEP250 Antibody

Sign In for Pricing
View Details
CEP250 Antibody
CSB-PA871581LA01HU-02 100 µg

CEP250 Antibody

Sign In for Pricing
View Details
GENLISA Human Total Prostate S Pecific Antigen (tPSA) ELISA
KBH16905 1x 96 Well

GENLISA Human Total Prostate S Pecific Antigen (tPSA) ELISA

Sign In for Pricing
View Details
ATP2A2, ID (ATP2A2, ATP2B, Sarcoplasmic/endoplasmic reticulum calcium ATPase 2, Calcium pump 2, Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform, Endoplasmic reticulum class 1/2 Ca (2+) ATPase) (AP) discontinued
032275-AP 200 µL

ATP2A2, ID (ATP2A2, ATP2B, Sarcoplasmic/endoplasmic reticulum calcium ATPase 2, Calcium pump 2, Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform, Endoplasmic reticulum class 1/2 Ca (2+) ATPase) (AP) discontinued

Sign In for Pricing
View Details
hsa-miR-5189-3p miRNA Inhibitor
MIH02883 2x 5.0 nmol

hsa-miR-5189-3p miRNA Inhibitor

Sign In for Pricing
View Details
Compound Fr16704
Fr16704-01 1 g

Compound Fr16704

Sign In for Pricing
View Details