Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Tumor necrosis factor (Tnf), partial

This Recombinant Rat Tumor necrosis factor (Tnf), partial spans the amino acid sequence from region 80-235aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2

UniProt

P16599

Expression Region

80-235aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGPAT1 (1-acyl-sn-glycerol-3-phosphate Acyltransferase alpha, 1-acylglycerol-3-phosphate O-acyltransferase 1, G15, LPAATA, 1-AGPAT1, LPAAT-alpha) (Biotin)
MBS6444943-01 0.1 mL

AGPAT1 (1-acyl-sn-glycerol-3-phosphate Acyltransferase alpha, 1-acylglycerol-3-phosphate O-acyltransferase 1, G15, LPAATA, 1-AGPAT1, LPAAT-alpha) (Biotin)

Sign In for Pricing
View Details
AGPAT1 (1-acyl-sn-glycerol-3-phosphate Acyltransferase alpha, 1-acylglycerol-3-phosphate O-acyltransferase 1, G15, LPAATA, 1-AGPAT1, LPAAT-alpha) (Biotin)
MBS6444943-02 5x 0.1 mL

AGPAT1 (1-acyl-sn-glycerol-3-phosphate Acyltransferase alpha, 1-acylglycerol-3-phosphate O-acyltransferase 1, G15, LPAATA, 1-AGPAT1, LPAAT-alpha) (Biotin)

Sign In for Pricing
View Details
UFD1 Rabbit Polyclonal Antibody
E28PN1480 100 µL

UFD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Immortalized Human Endocervical Epithelial Cells- HPV E6/E7 (A2EN)
T0595 1x106 cells / 1.0 mL

Immortalized Human Endocervical Epithelial Cells- HPV E6/E7 (A2EN)

Sign In for Pricing
View Details
DMWD Protein Vector (Mouse) (pPB-C-His)
PV172518 500 ng

DMWD Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal HLA ABC Antibody (Bra-23/9) [Alexa Fluor 700]
NBP3-20835AF700 0.1 mL

Mouse Monoclonal HLA ABC Antibody (Bra-23/9) [Alexa Fluor 700]

Sign In for Pricing
View Details