Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH-cytochrome b5 reductase 2 (CYB5R2)

This Recombinant Human NADH-cytochrome b5 reductase 2 (CYB5R2) spans the amino acid sequence from region 1-237aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B5R.2; CYB5R2

UniProt

Q6BCY4

Expression Region

1-237aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGPWSAEGATLLSNSAQFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLAMF9 Lentiviral Activation Particles (m)
sc-430206-LAC 200 µL

SLAMF9 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Lce3a (NM_001039594) Mouse Tagged ORF Clone Lentiviral Particle
MR212162L3V 200 µL

Lce3a (NM_001039594) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RGD1564575 Protein Vector (Rat) (pPB-C-His)
PV300878 500 ng

RGD1564575 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
TMSB15B ORF Vector (Human) (pORF)
47160012 1.0 µg DNA

TMSB15B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
YX862
orb2664330-01 50 mg

YX862

Sign In for Pricing
View Details
YX862
orb2664330-02 10 mg

YX862

Sign In for Pricing
View Details